![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.19: Aquaporin-like [81339] (1 superfamily) core: 8 helices, 2 short helices are surrounded by 6 long transmembrane helices |
![]() | Superfamily f.19.1: Aquaporin-like [81338] (2 families) ![]() |
![]() | Family f.19.1.1: Aquaporin-like [56895] (5 proteins) duplication: consist of two similar structural parts automatically mapped to Pfam PF00230 |
![]() | Protein Aquaporin Z [103470] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [103471] (6 PDB entries) |
![]() | Domain d2abmf1: 2abm F:1-227 [126524] automatically matched to d1rc2a_ complexed with 3pg, aga, bgl, pee, po4, poq |
PDB Entry: 2abm (more details), 3.2 Å
SCOPe Domain Sequences for d2abmf1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2abmf1 f.19.1.1 (F:1-227) Aquaporin Z {Escherichia coli [TaxId: 562]} mfrklaaecfgtfwlvfggcgsavlaagfpelgigfagvalafgltvltmafavghisgg hfnpavtiglwaggrfpakevvgyviaqvvggivaaallyliasgktgfdaaasgfasng ygehspggysmlsalvvelvlsagfllvihgatdkfapagfapiaiglaltlihlisipv tntsvnparstavaifqggwaleqlwffwvvpivggiiggliyrtll
Timeline for d2abmf1: