![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
![]() | Protein Class mu GST [81359] (3 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52867] (17 PDB entries) Uniprot P09488 ! Uniprot P28161 |
![]() | Domain d2ab6b2: 2ab6 B:1-84 [126510] Other proteins in same PDB: d2ab6a1, d2ab6b1, d2ab6c1, d2ab6d1 automated match to d1xw5a2 complexed with gsm |
PDB Entry: 2ab6 (more details), 2.5 Å
SCOPe Domain Sequences for d2ab6b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ab6b2 c.47.1.5 (B:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp ylidgthkitqsnailryiarkhn
Timeline for d2ab6b2: