SCOPe 2.08: Domain d2ab6b2: 2ab6 B:1-84

Lineage for d2ab6b2 (2ab6 B:1-84)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class mu GST [81359] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52867] (17 PDB entries)
   Uniprot P09488 ! Uniprot P28161

8. Domain d2ab6b2: 2ab6 B:1-84 [126510]
   Other proteins in same PDB: d2ab6a1, d2ab6b1, d2ab6c1, d2ab6d1
   automated match to d1xw5a2
   complexed with gsm

Details for d2ab6b2

PDB Entry: 2ab6, 2.5 Å

PDB Description: human glutathione s-transferase m2-2 (e.c.2.5.1.18) complexed with s- methylglutathione

PDB Compounds: (B:) Glutathione S-transferase Mu 2

SCOPe Domain Sequences for d2ab6b2:

Sequence; same for both SEQRES and ATOM records:

>d2ab6b2 c.47.1.5 (B:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

Timeline for d2ab6b2:

• d2ab6b2 first appeared in SCOP 1.73
  
• d2ab6b2 appears in SCOPe 2.07