Lineage for d2ab6a2 (2ab6 A:1-84)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2876812Protein Class mu GST [81359] (3 species)
  7. 2876820Species Human (Homo sapiens) [TaxId:9606] [52867] (17 PDB entries)
    Uniprot P09488 ! Uniprot P28161
  8. 2876852Domain d2ab6a2: 2ab6 A:1-84 [126508]
    Other proteins in same PDB: d2ab6a1, d2ab6b1, d2ab6c1, d2ab6d1
    automated match to d1xw5a2
    complexed with gsm

Details for d2ab6a2

PDB Entry: 2ab6 (more details), 2.5 Å

PDB Description: human glutathione s-transferase m2-2 (e.c.2.5.1.18) complexed with s- methylglutathione
PDB Compounds: (A:) Glutathione S-transferase Mu 2

SCOPe Domain Sequences for d2ab6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ab6a2 c.47.1.5 (A:1-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
pmtlgywnirglahsirllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
ylidgthkitqsnailryiarkhn

SCOPe Domain Coordinates for d2ab6a2:

Click to download the PDB-style file with coordinates for d2ab6a2.
(The format of our PDB-style files is described here.)

Timeline for d2ab6a2: