SCOPe 2.08: Domain d2aamd_: 2aam D:

Lineage for d2aamd_ (2aam D:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.15: TM1410-like [141796] (1 protein)
   Pfam PF03537

6. Protein Hypothetical protein TM1410 [141797] (1 species)

7. Species Thermotoga maritima [TaxId:2336] [141798] (1 PDB entry)
   Uniprot Q9X1D0 28-312

8. Domain d2aamd_: 2aam D: [126492]
   automated match to d2aama1
   complexed with gol, unl

Details for d2aamd_

PDB Entry: 2aam, 2.2 Å

PDB Description: Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution

PDB Compounds: (D:) Hypothetical protein TM1410

SCOPe Domain Sequences for d2aamd_:

Sequence; same for both SEQRES and ATOM records:

>d2aamd_ c.1.8.15 (D:) Hypothetical protein TM1410 {Thermotoga maritima [TaxId: 2336]}
tegwfmpfdnwlyqlqnadpveisssgfeiavidyskdgsesgeyspeeikimvdagvvp
vayvnigqaedyrfywkeswytntpewlgeedpawpgnyfvkywynewkeivfsyldrvi
dqgfkgiyldridsfeywaqegvisrrsaarkminfvleiaeyvrerkpdmliipqngen
ildfddgqlastvsgwavenlfylktipleenetksrleylirlnrkgkfilsvdyvddg
sdsfenisrildyyekakrngcipyaarsdleldemnviegiqppe

Timeline for d2aamd_:

• d2aamd_ first appeared in SCOP 1.73, called d2aamd1
  
• d2aamd_ appears in SCOPe 2.07