Lineage for d2aamd_ (2aam D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832334Family c.1.8.15: TM1410-like [141796] (1 protein)
    Pfam PF03537
  6. 2832335Protein Hypothetical protein TM1410 [141797] (1 species)
  7. 2832336Species Thermotoga maritima [TaxId:2336] [141798] (1 PDB entry)
    Uniprot Q9X1D0 28-312
  8. 2832340Domain d2aamd_: 2aam D: [126492]
    automated match to d2aama1
    complexed with gol, unl

Details for d2aamd_

PDB Entry: 2aam (more details), 2.2 Å

PDB Description: Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution
PDB Compounds: (D:) Hypothetical protein TM1410

SCOPe Domain Sequences for d2aamd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aamd_ c.1.8.15 (D:) Hypothetical protein TM1410 {Thermotoga maritima [TaxId: 2336]}
tegwfmpfdnwlyqlqnadpveisssgfeiavidyskdgsesgeyspeeikimvdagvvp
vayvnigqaedyrfywkeswytntpewlgeedpawpgnyfvkywynewkeivfsyldrvi
dqgfkgiyldridsfeywaqegvisrrsaarkminfvleiaeyvrerkpdmliipqngen
ildfddgqlastvsgwavenlfylktipleenetksrleylirlnrkgkfilsvdyvddg
sdsfenisrildyyekakrngcipyaarsdleldemnviegiqppe

SCOPe Domain Coordinates for d2aamd_:

Click to download the PDB-style file with coordinates for d2aamd_.
(The format of our PDB-style files is described here.)

Timeline for d2aamd_: