PDB entry 2aam

View 2aam on RCSB PDB site
Description: Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution
Class: hydrolase
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, hydrolase
Deposited on 2005-07-13, released 2005-07-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.216
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein TM1410
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1410
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1D0
      • modified residue (17)
      • modified residue (64)
      • modified residue (164)
      • modified residue (182)
      • modified residue (287)
    Domains in SCOPe 2.08: d2aama1
  • Chain 'B':
    Compound: Hypothetical protein TM1410
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1410
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1D0 (12-End)
      • modified residue (17)
      • modified residue (64)
      • modified residue (164)
      • modified residue (182)
      • modified residue (287)
    Domains in SCOPe 2.08: d2aamb_
  • Chain 'C':
    Compound: Hypothetical protein TM1410
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1410
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1D0 (12-End)
      • modified residue (17)
      • modified residue (64)
      • modified residue (164)
      • modified residue (182)
      • modified residue (287)
    Domains in SCOPe 2.08: d2aamc_
  • Chain 'D':
    Compound: Hypothetical protein TM1410
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1410
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1D0 (12-End)
      • modified residue (17)
      • modified residue (64)
      • modified residue (164)
      • modified residue (182)
      • modified residue (287)
    Domains in SCOPe 2.08: d2aamd_
  • Chain 'E':
    Compound: Hypothetical protein TM1410
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1410
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1D0 (12-End)
      • modified residue (17)
      • modified residue (64)
      • modified residue (164)
      • modified residue (182)
      • modified residue (287)
    Domains in SCOPe 2.08: d2aame_
  • Chain 'F':
    Compound: Hypothetical protein TM1410
    Species: Thermotoga maritima [TaxId:2336]
    Gene: tm1410
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1D0 (12-End)
      • modified residue (17)
      • modified residue (64)
      • modified residue (164)
      • modified residue (182)
      • modified residue (287)
    Domains in SCOPe 2.08: d2aamf_
  • Heterogens: UNL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aamA (A:)
    mgsdkihhhhhhtegwfmpfdnwlyqlqnadpveisssgfeiavidyskdgsesgeyspe
    eikimvdagvvpvayvnigqaedyrfywkeswytntpewlgeedpawpgnyfvkywynew
    keivfsyldrvidqgfkgiyldridsfeywaqegvisrrsaarkminfvleiaeyvrerk
    pdmliipqngenildfddgqlastvsgwavenlfylktipleenetksrleylirlnrkg
    kfilsvdyvddgsdsfenisrildyyekakrngcipyaarsdleldemnviegiqppeal
    kdyesrtyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aamA (A:)
    egwfmpfdnwlyqlqnadpveisssgfeiavidyskdgsesgeyspeeikimvdagvvpv
    ayvnigqaedyrfywkeswytntpewlgeedpawpgnyfvkywynewkeivfsyldrvid
    qgfkgiyldridsfeywaqegvisrrsaarkminfvleiaeyvrerkpdmliipqngeni
    ldfddgqlastvsgwavenlfylktipleenetksrleylirlnrkgkfilsvdyvddgs
    dsfenisrildyyekakrngcipyaarsdleldemnviegiqppe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2aamB (B:)
    mgsdkihhhhhhtegwfmpfdnwlyqlqnadpveisssgfeiavidyskdgsesgeyspe
    eikimvdagvvpvayvnigqaedyrfywkeswytntpewlgeedpawpgnyfvkywynew
    keivfsyldrvidqgfkgiyldridsfeywaqegvisrrsaarkminfvleiaeyvrerk
    pdmliipqngenildfddgqlastvsgwavenlfylktipleenetksrleylirlnrkg
    kfilsvdyvddgsdsfenisrildyyekakrngcipyaarsdleldemnviegiqppeal
    kdyesrtyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aamB (B:)
    tegwfmpfdnwlyqlqnadpveisssgfeiavidyskdgsesgeyspeeikimvdagvvp
    vayvnigqaedyrfywkeswytntpewlgeedpawpgnyfvkywynewkeivfsyldrvi
    dqgfkgiyldridsfeywaqegvisrrsaarkminfvleiaeyvrerkpdmliipqngen
    ildfddgqlastvsgwavenlfylktipleenetksrleylirlnrkgkfilsvdyvddg
    sdsfenisrildyyekakrngcipyaarsdleldemnviegiqppea
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2aamC (C:)
    mgsdkihhhhhhtegwfmpfdnwlyqlqnadpveisssgfeiavidyskdgsesgeyspe
    eikimvdagvvpvayvnigqaedyrfywkeswytntpewlgeedpawpgnyfvkywynew
    keivfsyldrvidqgfkgiyldridsfeywaqegvisrrsaarkminfvleiaeyvrerk
    pdmliipqngenildfddgqlastvsgwavenlfylktipleenetksrleylirlnrkg
    kfilsvdyvddgsdsfenisrildyyekakrngcipyaarsdleldemnviegiqppeal
    kdyesrtyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aamC (C:)
    tegwfmpfdnwlyqlqnadpveisssgfeiavidyskdgsesgeyspeeikimvdagvvp
    vayvnigqaedyrfywkeswytntpewlgeedpawpgnyfvkywynewkeivfsyldrvi
    dqgfkgiyldridsfeywaqegvisrrsaarkminfvleiaeyvrerkpdmliipqngen
    ildfddgqlastvsgwavenlfylktipleenetksrleylirlnrkgkfilsvdyvddg
    sdsfenisrildyyekakrngcipyaarsdleldemnviegiqppe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2aamD (D:)
    mgsdkihhhhhhtegwfmpfdnwlyqlqnadpveisssgfeiavidyskdgsesgeyspe
    eikimvdagvvpvayvnigqaedyrfywkeswytntpewlgeedpawpgnyfvkywynew
    keivfsyldrvidqgfkgiyldridsfeywaqegvisrrsaarkminfvleiaeyvrerk
    pdmliipqngenildfddgqlastvsgwavenlfylktipleenetksrleylirlnrkg
    kfilsvdyvddgsdsfenisrildyyekakrngcipyaarsdleldemnviegiqppeal
    kdyesrtyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aamD (D:)
    tegwfmpfdnwlyqlqnadpveisssgfeiavidyskdgsesgeyspeeikimvdagvvp
    vayvnigqaedyrfywkeswytntpewlgeedpawpgnyfvkywynewkeivfsyldrvi
    dqgfkgiyldridsfeywaqegvisrrsaarkminfvleiaeyvrerkpdmliipqngen
    ildfddgqlastvsgwavenlfylktipleenetksrleylirlnrkgkfilsvdyvddg
    sdsfenisrildyyekakrngcipyaarsdleldemnviegiqppe
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2aamE (E:)
    mgsdkihhhhhhtegwfmpfdnwlyqlqnadpveisssgfeiavidyskdgsesgeyspe
    eikimvdagvvpvayvnigqaedyrfywkeswytntpewlgeedpawpgnyfvkywynew
    keivfsyldrvidqgfkgiyldridsfeywaqegvisrrsaarkminfvleiaeyvrerk
    pdmliipqngenildfddgqlastvsgwavenlfylktipleenetksrleylirlnrkg
    kfilsvdyvddgsdsfenisrildyyekakrngcipyaarsdleldemnviegiqppeal
    kdyesrtyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aamE (E:)
    tegwfmpfdnwlyqlqnadpveisssgfeiavidyskdgsesgeyspeeikimvdagvvp
    vayvnigqaedyrfywkeswytntpewlgeedpawpgnyfvkywynewkeivfsyldrvi
    dqgfkgiyldridsfeywaqegvisrrsaarkminfvleiaeyvrerkpdmliipqngen
    ildfddgqlastvsgwavenlfylktipleenetksrleylirlnrkgkfilsvdyvddg
    sdsfenisrildyyekakrngcipyaarsdleldemnviegiqppea
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2aamF (F:)
    mgsdkihhhhhhtegwfmpfdnwlyqlqnadpveisssgfeiavidyskdgsesgeyspe
    eikimvdagvvpvayvnigqaedyrfywkeswytntpewlgeedpawpgnyfvkywynew
    keivfsyldrvidqgfkgiyldridsfeywaqegvisrrsaarkminfvleiaeyvrerk
    pdmliipqngenildfddgqlastvsgwavenlfylktipleenetksrleylirlnrkg
    kfilsvdyvddgsdsfenisrildyyekakrngcipyaarsdleldemnviegiqppeal
    kdyesrtyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aamF (F:)
    tegwfmpfdnwlyqlqnadpveisssgfeiavidyskdgsesgeyspeeikimvdagvvp
    vayvnigqaedyrfywkeswytntpewlgeedpawpgnyfvkywynewkeivfsyldrvi
    dqgfkgiyldridsfeywaqegvisrrsaarkminfvleiaeyvrerkpdmliipqngen
    ildfddgqlastvsgwavenlfylktipleenetksrleylirlnrkgkfilsvdyvddg
    sdsfenisrildyyekakrngcipyaarsdleldemnviegiqppe