Lineage for d2aamc_ (2aam C:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. Family c.1.8.15: TM1410-like [141796] (1 protein)
    Pfam PF03537
  6. Protein Hypothetical protein TM1410 [141797] (1 species)
  7. Species Thermotoga maritima [TaxId:2336] [141798] (1 PDB entry)
    Uniprot Q9X1D0 28-312
  8. Domain d2aamc_: 2aam C: [126491]
    automated match to d2aama1
    complexed with gol, unl

Details for d2aamc_

PDB Entry: 2aam (more details), 2.2 Å

PDB Description: Crystal structure of a putative glycosidase (tm1410) from thermotoga maritima at 2.20 A resolution
PDB Compounds: (C:) Hypothetical protein TM1410

SCOPe Domain Sequences for d2aamc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aamc_ c.1.8.15 (C:) Hypothetical protein TM1410 {Thermotoga maritima [TaxId: 2336]}
tegwfmpfdnwlyqlqnadpveisssgfeiavidyskdgsesgeyspeeikimvdagvvp
vayvnigqaedyrfywkeswytntpewlgeedpawpgnyfvkywynewkeivfsyldrvi
dqgfkgiyldridsfeywaqegvisrrsaarkminfvleiaeyvrerkpdmliipqngen
ildfddgqlastvsgwavenlfylktipleenetksrleylirlnrkgkfilsvdyvddg
sdsfenisrildyyekakrngcipyaarsdleldemnviegiqppe

SCOPe Domain Coordinates for d2aamc_ are not available.

Timeline for d2aamc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2aama1, d2aamb_, d2aamd_, d2aame_, d2aamf_