Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.10: ROK [110636] (8 proteins) Pfam PF00480 |
Protein N-acetylmannosamine kinase NanK [142471] (1 species) |
Species Escherichia coli [TaxId:562] [142472] (1 PDB entry) Uniprot P45425 1-119! Uniprot P45425 120-289 |
Domain d2aa4b2: 2aa4 B:120-289 [126468] automated match to d2aa4a2 complexed with zn |
PDB Entry: 2aa4 (more details), 2.2 Å
SCOPe Domain Sequences for d2aa4b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aa4b2 c.55.1.10 (B:120-289) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]} ditdmvfitvstgvgggvvsgcklltgpgglaghightladphgpvcgcgrtgcveaias grgiaaaaqgelagadaktiftragqgdeqaqqlihrsartlarliadikattdcqcvvv ggsvglaegylalvetylaqepaafhvdllaahyrhdagllgaallaqge
Timeline for d2aa4b2: