Lineage for d2aa4a2 (2aa4 A:120-289)
- Root: SCOPe 2.06
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) 
duplication contains two domains of this fold
Family c.55.1.10: ROK [110636] (8 proteins)
Pfam PF00480
Protein N-acetylmannosamine kinase NanK [142471] (1 species) Species Escherichia coli [TaxId:562] [142472] (1 PDB entry)
Uniprot P45425 1-119! Uniprot P45425 120-289
Domain d2aa4a2: 2aa4 A:120-289 [126466]
complexed with zn
Details for d2aa4a2
PDB Entry: 2aa4 (more details), 2.2 Å
PDB Description: crystal structure of escherichia coli putative n-acetylmannosamine kinase, new york structural genomics consortium
PDB Compounds: (A:) Putative N-acetylmannosamine kinaseSCOPe Domain Sequences for d2aa4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aa4a2 c.55.1.10 (A:120-289) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]}
ditdmvfitvstgvgggvvsgcklltgpgglaghightladphgpvcgcgrtgcveaias
grgiaaaaqgelagadaktiftragqgdeqaqqlihrsartlarliadikattdcqcvvv
ggsvglaegylalvetylaqepaafhvdllaahyrhdagllgaallaqge
SCOPe Domain Coordinates for d2aa4a2:
Click to download the PDB-style file with coordinates for d2aa4a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2aa4a2:
- d2aa4a2 first appeared in SCOP 1.73
- d2aa4a2 appears in SCOPe 2.05
- d2aa4a2 appears in SCOPe 2.07
- d2aa4a2 appears in the current release, SCOPe 2.08
View in 3D
