SCOPe 2.03: Domain d2a9vd_: 2a9v D:

Lineage for d2a9vd_ (2a9v D:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein GMP synthase subunit A, GuaAA [142065] (2 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [142066] (1 PDB entry)
   Uniprot Q9HJM3 1-196

8. Domain d2a9vd_: 2a9v D: [126455]
   automated match to d2a9va1
   complexed with cl, gol, scn

Details for d2a9vd_

PDB Entry: 2a9v, 2.24 Å

PDB Description: Crystal structure of a putative gmp synthase subunit a protein (ta0944m) from thermoplasma acidophilum at 2.45 A resolution

PDB Compounds: (D:) GMP synthase

SCOPe Domain Sequences for d2a9vd_:

Sequence; same for both SEQRES and ATOM records:

>d2a9vd_ c.23.16.1 (D:) GMP synthase subunit A, GuaAA {Thermoplasma acidophilum [TaxId: 2303]}
hhhmlkiyvvdnggqwthrewrvlrelgvdtkivpndidsseldgldglvlsggapnide
eldklgsvgkyiddhnypilgicvgaqfialhfgasvvkakhpefgktkvsvmhsenifg
glpseitvwenhndeiinlpddftlaassatcqvqgfyhktrpiyatqfhpevehtqygr
difrnfigicasyreiqkenf

Timeline for d2a9vd_:

• d2a9vd_ first appeared in SCOP 1.73, called d2a9vd1
  
• d2a9vd_ appears in SCOPe 2.02
  
• d2a9vd_ appears in SCOPe 2.04
  
• d2a9vd_ appears in the current release, SCOPe 2.08, called d2a9vd2