| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
| Protein GMP synthase subunit A, GuaAA [142065] (2 species) |
| Species Thermoplasma acidophilum [TaxId:2303] [142066] (1 PDB entry) Uniprot Q9HJM3 1-196 |
| Domain d2a9va1: 2a9v A:1-196 [126452] complexed with cl, gol, scn |
PDB Entry: 2a9v (more details), 2.24 Å
SCOPe Domain Sequences for d2a9va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Thermoplasma acidophilum [TaxId: 2303]}
mlkiyvvdnggqwthrewrvlrelgvdtkivpndidsseldgldglvlsggapnideeld
klgsvgkyiddhnypilgicvgaqfialhfgasvvkakhpefgktkvsvmhsenifgglp
seitvwenhndeiinlpddftlaassatcqvqgfyhktrpiyatqfhpevehtqygrdif
rnfigicasyreiqke
Timeline for d2a9va1: