Lineage for d2a9va1 (2a9v A:1-196)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2858751Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
    contains a catalytic Cys-His-Glu triad
  6. 2858865Protein GMP synthase subunit A, GuaAA [142065] (2 species)
  7. 2858868Species Thermoplasma acidophilum [TaxId:2303] [142066] (1 PDB entry)
    Uniprot Q9HJM3 1-196
  8. 2858869Domain d2a9va1: 2a9v A:1-196 [126452]
    Other proteins in same PDB: d2a9va2, d2a9vc3, d2a9vd3
    complexed with cl, gol, scn

Details for d2a9va1

PDB Entry: 2a9v (more details), 2.24 Å

PDB Description: Crystal structure of a putative gmp synthase subunit a protein (ta0944m) from thermoplasma acidophilum at 2.45 A resolution
PDB Compounds: (A:) GMP synthase

SCOPe Domain Sequences for d2a9va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a9va1 c.23.16.1 (A:1-196) GMP synthase subunit A, GuaAA {Thermoplasma acidophilum [TaxId: 2303]}
mlkiyvvdnggqwthrewrvlrelgvdtkivpndidsseldgldglvlsggapnideeld
klgsvgkyiddhnypilgicvgaqfialhfgasvvkakhpefgktkvsvmhsenifgglp
seitvwenhndeiinlpddftlaassatcqvqgfyhktrpiyatqfhpevehtqygrdif
rnfigicasyreiqke

SCOPe Domain Coordinates for d2a9va1:

Click to download the PDB-style file with coordinates for d2a9va1.
(The format of our PDB-style files is described here.)

Timeline for d2a9va1: