SCOP 1.73: Domain d2a9vd1: 2a9v D:1-196

Lineage for d2a9vd1 (2a9v D:1-196)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (8 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (11 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein GMP synthase subunit A, GuaAA [142065] (2 species)

7. Species Archaeon Thermoplasma acidophilum [TaxId:2303] [142066] (1 PDB entry)

8. Domain d2a9vd1: 2a9v D:1-196 [126455]
   automatically matched to 2A9V A:1-196
   complexed with cl, gol, scn

Details for d2a9vd1

PDB Entry: 2a9v, 2.24 Å

PDB Description: Crystal structure of a putative gmp synthase subunit a protein (ta0944m) from thermoplasma acidophilum at 2.45 A resolution

PDB Compounds: (D:) GMP synthase

SCOP Domain Sequences for d2a9vd1:

Sequence; same for both SEQRES and ATOM records:

>d2a9vd1 c.23.16.1 (D:1-196) GMP synthase subunit A, GuaAA {Archaeon Thermoplasma acidophilum [TaxId: 2303]}
mlkiyvvdnggqwthrewrvlrelgvdtkivpndidsseldgldglvlsggapnideeld
klgsvgkyiddhnypilgicvgaqfialhfgasvvkakhpefgktkvsvmhsenifgglp
seitvwenhndeiinlpddftlaassatcqvqgfyhktrpiyatqfhpevehtqygrdif
rnfigicasyreiqke

Timeline for d2a9vd1:

• d2a9vd1 is new in SCOP 1.73
  
• d2a9vd1 appears in SCOP 1.75
  
• d2a9vd1 appears in the current release, SCOPe 2.08, called d2a9vd2