SCOPe 2.03: Domain d2a8qb_: 2a8q B:

Lineage for d2a8qb_ (2a8q B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.113: Nudix [55810] (1 superfamily)
   beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
   contains beta-grasp motif

4. Superfamily d.113.1: Nudix [55811] (8 families)

5. Family d.113.1.1: MutT-like [55812] (17 proteins)

6. Protein automated matches [190465] (3 species)
   not a true protein

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [187382] (6 PDB entries)

8. Domain d2a8qb_: 2a8q B: [126413]
   automated match to d1u20a1
   protein/RNA complex; complexed with mn, pop

Details for d2a8qb_

PDB Entry: 2a8q, 2.6 Å

PDB Description: 2.6 angstrom crystal structure of the complex between the nuclear snorna decapping nudix hydrolase x29 and manganese in the presence of 7-methyl-gdp

PDB Compounds: (B:) U8 snoRNA-binding protein X29

SCOPe Domain Sequences for d2a8qb_:

Sequence; same for both SEQRES and ATOM records:

>d2a8qb_ d.113.1.1 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
prnisreeslqlegykhachallhapsqaklfdrvpirrvllmmmrfdgrlgfpggfvdt
rdisleeglkreleeelgpalatvevteddyrssqvrehpqkcvthfyikelkleeieri
eaeavnakdhglevmglirvplytlrdrvgglpaflcnnfignsksqllyalrslkllre
dqiqevlkash

Timeline for d2a8qb_:

• d2a8qb_ first appeared in SCOP 1.73, called d2a8qb1
  
• d2a8qb_ appears in SCOPe 2.02
  
• d2a8qb_ appears in SCOPe 2.04
  
• d2a8qb_ appears in the current release, SCOPe 2.08