Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.113: Nudix [55810] (1 superfamily) beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet contains beta-grasp motif |
Superfamily d.113.1: Nudix [55811] (8 families) |
Family d.113.1.1: MutT-like [55812] (17 proteins) |
Protein automated matches [190465] (6 species) not a true protein |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [187382] (6 PDB entries) |
Domain d2a8qb_: 2a8q B: [126413] automated match to d1u20a1 protein/RNA complex; complexed with mn, pop |
PDB Entry: 2a8q (more details), 2.6 Å
SCOPe Domain Sequences for d2a8qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a8qb_ d.113.1.1 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]} prnisreeslqlegykhachallhapsqaklfdrvpirrvllmmmrfdgrlgfpggfvdt rdisleeglkreleeelgpalatvevteddyrssqvrehpqkcvthfyikelkleeieri eaeavnakdhglevmglirvplytlrdrvgglpaflcnnfignsksqllyalrslkllre dqiqevlkash
Timeline for d2a8qb_: