SCOPe 2.04: Domain d2a6rc_: 2a6r C:

Lineage for d2a6rc_ (2a6r C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.298: RelE-like [143010] (1 superfamily)
   beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432

4. Superfamily d.298.1: RelE-like [143011] (3 families)
   Toxin component of plasmid stabilisation system

5. Family d.298.1.1: YoeB/Txe-like [143012] (1 protein)
   Pfam PF06769

6. Protein Toxin YoeB [143013] (1 species)

7. Species Escherichia coli [TaxId:562] [143014] (3 PDB entries)
   Uniprot P69348 1-84

8. Domain d2a6rc_: 2a6r C: [126301]
   automated match to d2a6qe1
   complexed with mg

Details for d2a6rc_

PDB Entry: 2a6r, 2.05 Å

PDB Description: crystal structure of yoeb under peg condition

PDB Compounds: (C:) Toxin yoeB

SCOPe Domain Sequences for d2a6rc_:

Sequence; same for both SEQRES and ATOM records:

>d2a6rc_ d.298.1.1 (C:) Toxin YoeB {Escherichia coli [TaxId: 562]}
mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
teehrlvyavtddslliaacryh

Timeline for d2a6rc_:

• d2a6rc_ first appeared in SCOP 1.73, called d2a6rc1
  
• d2a6rc_ appears in SCOPe 2.03
  
• d2a6rc_ appears in SCOPe 2.05
  
• d2a6rc_ appears in the current release, SCOPe 2.08