| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.298: RelE-like [143010] (1 superfamily) beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432 |
Superfamily d.298.1: RelE-like [143011] (3 families) ![]() Toxin component of plasmid stabilisation system |
| Family d.298.1.1: YoeB/Txe-like [143012] (1 protein) Pfam PF06769 |
| Protein Toxin YoeB [143013] (1 species) |
| Species Escherichia coli [TaxId:562] [143014] (3 PDB entries) Uniprot P69348 1-84 |
| Domain d2a6ra_: 2a6r A: [126299] automated match to d2a6qe1 complexed with mg |
PDB Entry: 2a6r (more details), 2.05 Å
SCOPe Domain Sequences for d2a6ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6ra_ d.298.1.1 (A:) Toxin YoeB {Escherichia coli [TaxId: 562]}
mkliwseeswddylywqetdkrivkkinelikdtrrtpfegkgkpeplkhnlsgfwsrri
teehrlvyavtddslliaacryhy
Timeline for d2a6ra_: