Lineage for d2a6qc2 (2a6q C:10-92)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2616299Fold d.306: YefM-like [143119] (1 superfamily)
    core: beta-alpha(2)-beta(2)-alpha; mixed beta-sheet, order:123, strands 1 and 2 are parallel; forms compact dimer with a single beta-sheet;
  4. 2616300Superfamily d.306.1: YefM-like [143120] (2 families) (S)
  5. 2616301Family d.306.1.1: YefM-like [143121] (2 proteins)
    antitoxin component of the YefM/YoeB-like system; binds to the toxin component wia extra C-terminal tail, unstructured in the free state, but adopting a RelB-like conformation in the bound state
    automatically mapped to Pfam PF02604
  6. 2616302Protein Antitoxin YefM [143122] (1 species)
  7. 2616303Species Escherichia coli [TaxId:562] [143123] (1 PDB entry)
    Uniprot P69346 1-55! Uniprot P69346 1-83
  8. 2616306Domain d2a6qc2: 2a6q C:10-92 [126295]
    Other proteins in same PDB: d2a6qa2, d2a6qb2, d2a6qc3, d2a6qd3, d2a6qe1, d2a6qf_
    automated match to d2a6qa1

Details for d2a6qc2

PDB Entry: 2a6q (more details), 2.05 Å

PDB Description: crystal structure of yefm-yoeb complex
PDB Compounds: (C:) Antitoxin yefM

SCOPe Domain Sequences for d2a6qc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6qc2 d.306.1.1 (C:10-92) Antitoxin YefM {Escherichia coli [TaxId: 562]}
mrtisysearqnlsatmmkavedhapilitrqngeacvlmsleeynsleetayllrspan
arrlmdsidslksgkgtekdiie

SCOPe Domain Coordinates for d2a6qc2:

Click to download the PDB-style file with coordinates for d2a6qc2.
(The format of our PDB-style files is described here.)

Timeline for d2a6qc2: