| Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
| Fold d.306: YefM-like [143119] (1 superfamily) core: beta-alpha(2)-beta(2)-alpha; mixed beta-sheet, order:123, strands 1 and 2 are parallel; forms compact dimer with a single beta-sheet; |
Superfamily d.306.1: YefM-like [143120] (1 family) ![]() |
| Family d.306.1.1: YefM-like [143121] (2 proteins) antitoxin component of the YefM/YoeB-like system; binds to the toxin component wia extra C-terminal tail, unstructured in the free state, but adopting a RelB-like conformation in the bound state |
| Protein Antitoxin YefM [143122] (1 species) |
| Species Escherichia coli [TaxId:562] [143123] (1 PDB entry) |
| Domain d2a6qc1: 2a6q C:10-92 [126295] Other proteins in same PDB: d2a6qe1, d2a6qf1 automatically matched to 2A6Q A:10-92 |
PDB Entry: 2a6q (more details), 2.05 Å
SCOP Domain Sequences for d2a6qc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a6qc1 d.306.1.1 (C:10-92) Antitoxin YefM {Escherichia coli [TaxId: 562]}
mrtisysearqnlsatmmkavedhapilitrqngeacvlmsleeynsleetayllrspan
arrlmdsidslksgkgtekdiie
Timeline for d2a6qc1: