Lineage for d2a6qc1 (2a6q C:10-92)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882321Fold d.306: YefM-like [143119] (1 superfamily)
    core: beta-alpha(2)-beta(2)-alpha; mixed beta-sheet, order:123, strands 1 and 2 are parallel; forms compact dimer with a single beta-sheet;
  4. 882322Superfamily d.306.1: YefM-like [143120] (1 family) (S)
  5. 882323Family d.306.1.1: YefM-like [143121] (2 proteins)
    antitoxin component of the YefM/YoeB-like system; binds to the toxin component wia extra C-terminal tail, unstructured in the free state, but adopting a RelB-like conformation in the bound state
  6. 882324Protein Antitoxin YefM [143122] (1 species)
  7. 882325Species Escherichia coli [TaxId:562] [143123] (1 PDB entry)
    Uniprot P69346 1-55! Uniprot P69346 1-83
  8. 882328Domain d2a6qc1: 2a6q C:10-92 [126295]
    Other proteins in same PDB: d2a6qe1, d2a6qf1
    automatically matched to 2A6Q A:10-92

Details for d2a6qc1

PDB Entry: 2a6q (more details), 2.05 Å

PDB Description: crystal structure of yefm-yoeb complex
PDB Compounds: (C:) Antitoxin yefM

SCOP Domain Sequences for d2a6qc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6qc1 d.306.1.1 (C:10-92) Antitoxin YefM {Escherichia coli [TaxId: 562]}
mrtisysearqnlsatmmkavedhapilitrqngeacvlmsleeynsleetayllrspan
arrlmdsidslksgkgtekdiie

SCOP Domain Coordinates for d2a6qc1:

Click to download the PDB-style file with coordinates for d2a6qc1.
(The format of our PDB-style files is described here.)

Timeline for d2a6qc1: