SCOPe 2.04: Domain d2a6qc_: 2a6q C:

Lineage for d2a6qc_ (2a6q C:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.306: YefM-like [143119] (1 superfamily)
   core: beta-alpha(2)-beta(2)-alpha; mixed beta-sheet, order:123, strands 1 and 2 are parallel; forms compact dimer with a single beta-sheet;

4. Superfamily d.306.1: YefM-like [143120] (2 families)

5. Family d.306.1.1: YefM-like [143121] (2 proteins)
   antitoxin component of the YefM/YoeB-like system; binds to the toxin component wia extra C-terminal tail, unstructured in the free state, but adopting a RelB-like conformation in the bound state
   automatically mapped to Pfam PF02604

6. Protein Antitoxin YefM [143122] (1 species)

7. Species Escherichia coli [TaxId:562] [143123] (1 PDB entry)
   Uniprot P69346 1-55! Uniprot P69346 1-83

8. Domain d2a6qc_: 2a6q C: [126295]
   Other proteins in same PDB: d2a6qe1, d2a6qf_
   automated match to d2a6qa1

Details for d2a6qc_

PDB Entry: 2a6q, 2.05 Å

PDB Description: crystal structure of yefm-yoeb complex

PDB Compounds: (C:) Antitoxin yefM

SCOPe Domain Sequences for d2a6qc_:

Sequence; same for both SEQRES and ATOM records:

>d2a6qc_ d.306.1.1 (C:) Antitoxin YefM {Escherichia coli [TaxId: 562]}
gphmrtisysearqnlsatmmkavedhapilitrqngeacvlmsleeynsleetayllrs
panarrlmdsidslksgkgtekdiie

Timeline for d2a6qc_:

• d2a6qc_ first appeared in SCOP 1.73, called d2a6qc1
  
• d2a6qc_ appears in SCOPe 2.03
  
• d2a6qc_ appears in SCOPe 2.05
  
• d2a6qc_ appears in the current release, SCOPe 2.08, called d2a6qc2