Lineage for d2a6ee1 (2a6e E:2-96)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649980Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 649981Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 649982Family a.143.1.1: RNA polymerase omega subunit [63563] (1 protein)
    4 helices; irregular array
  6. 649983Protein RNA polymerase omega subunit [63564] (2 species)
  7. 649988Species Thermus thermophilus [TaxId:274] [74729] (9 PDB entries)
  8. 650001Domain d2a6ee1: 2a6e E:2-96 [126246]
    Other proteins in same PDB: d2a6ea1, d2a6ea2, d2a6eb1, d2a6eb2, d2a6ec1, d2a6ed1, d2a6ef1, d2a6ef2, d2a6ef3, d2a6ek1, d2a6ek2, d2a6el1, d2a6el2, d2a6em1, d2a6en1, d2a6ep1, d2a6ep2, d2a6ep3
    automatically matched to d1iw7e_
    complexed with mg, zn

Details for d2a6ee1

PDB Entry: 2a6e (more details), 2.8 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme
PDB Compounds: (E:) RNA polymerase omega chain

SCOP Domain Sequences for d2a6ee1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6ee1 a.143.1.1 (E:2-96) RNA polymerase omega subunit {Thermus thermophilus [TaxId: 274]}
aepgidklfgmvdskyrltvvvakraqqllrhgfkntvlepeerpkmqtleglfddpnae
twamkelltgrlvfgenlvpedrlqkemeriypge

SCOP Domain Coordinates for d2a6ee1:

Click to download the PDB-style file with coordinates for d2a6ee1.
(The format of our PDB-style files is described here.)

Timeline for d2a6ee1: