Lineage for d2a6el1 (2a6e L:1-49,L:173-229)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726910Fold d.74: DCoH-like [55247] (4 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 726990Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (2 families) (S)
    form homo and heterodimers
  5. 726991Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (2 proteins)
  6. 726992Protein RNA polymerase alpha [55259] (3 species)
  7. 727007Species Thermus thermophilus [TaxId:274] [75478] (9 PDB entries)
  8. 727035Domain d2a6el1: 2a6e L:1-49,L:173-229 [126252]
    Other proteins in same PDB: d2a6ea2, d2a6eb2, d2a6ec1, d2a6ed1, d2a6ee1, d2a6ef1, d2a6ef2, d2a6ef3, d2a6ek2, d2a6el2, d2a6em1, d2a6en1, d2a6eo1, d2a6ep1, d2a6ep2, d2a6ep3
    automatically matched to d1iw7a1
    complexed with mg, zn

Details for d2a6el1

PDB Entry: 2a6e (more details), 2.8 Å

PDB Description: Crystal structure of the T. Thermophilus RNA polymerase holoenzyme
PDB Compounds: (L:) DNA-directed RNA polymerase alpha chain

SCOP Domain Sequences for d2a6el1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a6el1 d.74.3.1 (L:1-49,L:173-229) RNA polymerase alpha {Thermus thermophilus [TaxId: 274]}
mldsklkapvftvrtqgreygefvleplergfgvtlgnplrrillssipXpvrrvafqve
dtrlgqrtdldkltlriwtdgsvtplealnqaveilrehltyfsnpq

SCOP Domain Coordinates for d2a6el1:

Click to download the PDB-style file with coordinates for d2a6el1.
(The format of our PDB-style files is described here.)

Timeline for d2a6el1: