| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) ![]() automatically mapped to Pfam PF01000 |
| Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins) |
| Protein RNA polymerase alpha subunit [56555] (3 species) |
| Species Thermus thermophilus [TaxId:274] [75595] (15 PDB entries) Uniprot Q9Z9H6; part of multichain biological unit |
| Domain d2a68b2: 2a68 B:50-172 [126194] Other proteins in same PDB: d2a68a1, d2a68b1, d2a68c_, d2a68d_, d2a68e_, d2a68f1, d2a68f2, d2a68f3, d2a68k1, d2a68l1, d2a68m_, d2a68n_, d2a68o_, d2a68p1, d2a68p2, d2a68p3 automated match to d1smya2 protein/RNA complex; complexed with mg, rbt, zn |
PDB Entry: 2a68 (more details), 2.5 Å
SCOPe Domain Sequences for d2a68b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a68b2 d.181.1.1 (B:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs
Timeline for d2a68b2: