Lineage for d2a68f3 (2a68 F:74-257)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2018296Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 2018297Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) (S)
  5. 2018298Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins)
  6. 2018314Protein Sigma70 [88948] (2 species)
  7. 2018317Species Thermus thermophilus [TaxId:274] [88949] (10 PDB entries)
    Uniprot Q9WX78
  8. 2018324Domain d2a68f3: 2a68 F:74-257 [126200]
    Other proteins in same PDB: d2a68a1, d2a68a2, d2a68b1, d2a68b2, d2a68c_, d2a68d_, d2a68e_, d2a68f1, d2a68f2, d2a68k1, d2a68k2, d2a68l1, d2a68l2, d2a68m_, d2a68n_, d2a68o_, d2a68p1, d2a68p2
    automated match to d1smyf3
    protein/RNA complex; complexed with mg, rbt, zn

Details for d2a68f3

PDB Entry: 2a68 (more details), 2.5 Å

PDB Description: Crystal structure of the T. thermophilus RNA polymerase holoenzyme in complex with antibiotic rifabutin
PDB Compounds: (F:) RNA polymerase sigma factor rpoD

SCOPe Domain Sequences for d2a68f3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a68f3 a.177.1.1 (F:74-257) Sigma70 {Thermus thermophilus [TaxId: 274]}
kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
qart

SCOPe Domain Coordinates for d2a68f3:

Click to download the PDB-style file with coordinates for d2a68f3.
(The format of our PDB-style files is described here.)

Timeline for d2a68f3: