SCOPe 2.01: Domain d2a5ca_: 2a5c A:

Lineage for d2a5ca_ (2a5c A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [186931] (19 PDB entries)

8. Domain d2a5ca_: 2a5c A: [126170]
   automated match to d1ij8b_
   protein/DNA complex; complexed with 8da, nag

Details for d2a5ca_

PDB Entry: 2a5c, 2.5 Å

PDB Description: structure of avidin in complex with the ligand 8-oxodeoxyadenosine

PDB Compounds: (A:) Avidin

SCOPe Domain Sequences for d2a5ca_:

Sequence; same for both SEQRES and ATOM records:

>d2a5ca_ b.61.1.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
trl

Timeline for d2a5ca_:

• d2a5ca_ first appeared in SCOP 1.73, called d2a5ca1
  
• d2a5ca_ was called d2a5ca1 in SCOP 1.75
  
• d2a5ca_ appears in SCOPe 2.02
  
• d2a5ca_ appears in the current release, SCOPe 2.08