Lineage for d2a5ca_ (2a5c A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families) (S)
  5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)
  6. Protein automated matches [190191] (2 species)
    not a true protein
  7. Species Chicken (Gallus gallus) [TaxId:9031] [186931] (28 PDB entries)
  8. Domain d2a5ca_: 2a5c A: [126170]
    automated match to d1ij8b_
    protein/DNA complex; complexed with 8da, nag

Details for d2a5ca_

PDB Entry: 2a5c (more details), 2.5 Å

PDB Description: structure of avidin in complex with the ligand 8-oxodeoxyadenosine
PDB Compounds: (A:) Avidin

SCOPe Domain Sequences for d2a5ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a5ca_ b.61.1.1 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
arkcsltgkwtndlgsnmtigavnsrgeftgtyttavtatsneikesplhgtentinkrt
qptfgftvnwkfsesttvftgqcfidrngkevlktmwllrssvndigddwkatrvginif
trl

SCOPe Domain Coordinates for d2a5ca_ are not available.

Timeline for d2a5ca_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2a5cb_