Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins) duplication: consists of two clear structural repeats each having this fold subunit fold and dimeric assembly are similar to those of glyoxalase |
Protein automated matches [190190] (5 species) not a true protein |
Species Streptomyces caespitosus [TaxId:53502] [186930] (2 PDB entries) |
Domain d2a4xb_: 2a4x B: [126167] automated match to d1kmza_ complexed with blm |
PDB Entry: 2a4x (more details), 1.4 Å
SCOPe Domain Sequences for d2a4xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a4xb_ d.32.1.2 (B:) automated matches {Streptomyces caespitosus [TaxId: 53502]} sarislfavvvedmakslefyrklgveipaeadsaphteavldggirlawdtvetvrsyd pewqaptgghrfaiafefpdtasvdkkyaelvdagyeghlkpwnavwgqryaivkdpdgn vvdlfapl
Timeline for d2a4xb_: