SCOPe 2.02: Domain d2a4xb_: 2a4x B:

Lineage for d2a4xb_ (2a4x B:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
   duplication: consists of two clear structural repeats each having this fold
   subunit fold and dimeric assembly are similar to those of glyoxalase

6. Protein automated matches [190190] (5 species)
   not a true protein

7. Species Streptomyces caespitosus [TaxId:53502] [186930] (2 PDB entries)

8. Domain d2a4xb_: 2a4x B: [126167]
   automated match to d1kmza_
   complexed with blm

Details for d2a4xb_

PDB Entry: 2a4x, 1.4 Å

PDB Description: Crystal Structure Of Mitomycin C-Binding Protein Complexed with Metal-Free Bleomycin A2

PDB Compounds: (B:) mitomycin-binding protein

SCOPe Domain Sequences for d2a4xb_:

Sequence; same for both SEQRES and ATOM records:

>d2a4xb_ d.32.1.2 (B:) automated matches {Streptomyces caespitosus [TaxId: 53502]}
sarislfavvvedmakslefyrklgveipaeadsaphteavldggirlawdtvetvrsyd
pewqaptgghrfaiafefpdtasvdkkyaelvdagyeghlkpwnavwgqryaivkdpdgn
vvdlfapl

Timeline for d2a4xb_:

• d2a4xb_ first appeared in SCOP 1.73, called d2a4xb1
  
• d2a4xb_ appears in SCOPe 2.01
  
• d2a4xb_ appears in SCOPe 2.03
  
• d2a4xb_ appears in the current release, SCOPe 2.08