Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) |
Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins) duplication: consists of two clear structural repeats each having this fold subunit fold and dimeric assembly are similar to those of glyoxalase |
Protein Mitomycin resistance protein D, MRD [75394] (1 species) |
Species Streptomyces lavendulae [TaxId:1914] [75395] (2 PDB entries) |
Domain d1kmza_: 1kmz A: [72759] |
PDB Entry: 1kmz (more details), 1.5 Å
SCOPe Domain Sequences for d1kmza_:
Sequence, based on SEQRES records: (download)
>d1kmza_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} arislfavvvedmakslefyrklgveipaeadsaphteavldggirlawdtvetvrsydp ewqaptgghrfaiafefpdtasvdkkyaelvdagyeghlkpwnavwgqryaivkdpdgnv vdlfaplp
>d1kmza_ d.32.1.2 (A:) Mitomycin resistance protein D, MRD {Streptomyces lavendulae [TaxId: 1914]} arislfavvvedmakslefyrklgveipaeadsaphteavldggirlawdtvetvrsydp ewqaghrfaiafefpdtasvdkkyaelvdagyeghlkpwnavwgqryaivkdpdgnvvdl faplp
Timeline for d1kmza_: