Lineage for d2a4oa_ (2a4o A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545310Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1545311Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1547439Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)
  6. 1547444Protein 3C cysteine protease (picornain 3C) [50604] (9 species)
  7. 1547474Species Human hepatitis a virus hu/northern africa/mbb/1978 [TaxId:12100] [186929] (2 PDB entries)
  8. 1547476Domain d2a4oa_: 2a4o A: [126161]
    automated match to d1qa7b_
    complexed with ace, bbl

Details for d2a4oa_

PDB Entry: 2a4o (more details), 1.55 Å

PDB Description: dual modes of modification of hepatitis a virus 3c protease by a serine derived beta-lactone: selective crytstallization and high resolution structure of the his102 adduct
PDB Compounds: (A:) Probable protein P3C

SCOPe Domain Sequences for d2a4oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a4oa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human hepatitis a virus hu/northern africa/mbb/1978 [TaxId: 12100]}
stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn
rggtyysisagnvviqsldvgfqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv
ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn
qsiqnailgihvaggnsilvaklvtqemfqni

SCOPe Domain Coordinates for d2a4oa_:

Click to download the PDB-style file with coordinates for d2a4oa_.
(The format of our PDB-style files is described here.)

Timeline for d2a4oa_: