Class b: All beta proteins [48724] (180 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins) |
Protein 3C cysteine protease (picornain 3C) [50604] (9 species) |
Species Human hepatitis a virus hu/northern africa/mbb/1978 [TaxId:12100] [186929] (2 PDB entries) |
Domain d2a4oa_: 2a4o A: [126161] automated match to d1qa7b_ complexed with ace, bbl |
PDB Entry: 2a4o (more details), 1.55 Å
SCOPe Domain Sequences for d2a4oa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a4oa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human hepatitis a virus hu/northern africa/mbb/1978 [TaxId: 12100]} stleiaglvrknlvqfgvgekngsvrwvmnalgvkddwllvpshaykfekdyemmefyfn rggtyysisagnvviqsldvgfqdvvlmkvptipkfrditqhfikkgdvpralnrlatlv ttvngtpmlisegplkmeekatyvhkkndgttvdltvdqawrgkgeglpgmcggalvssn qsiqnailgihvaggnsilvaklvtqemfqni
Timeline for d2a4oa_: