Lineage for d2a3wd_ (2a3w D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943754Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 943755Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 944683Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
  6. 944751Protein Serum amyloid P component (SAP) [49952] (1 species)
  7. 944752Species Human (Homo sapiens) [TaxId:9606] [49953] (9 PDB entries)
  8. 944776Domain d2a3wd_: 2a3w D: [126102]
    automated match to d1gyka_
    complexed with ca, cpj

Details for d2a3wd_

PDB Entry: 2a3w (more details), 2.2 Å

PDB Description: decameric structure of human serum amyloid p-component bound to bis-1, 2-{[(z)-2-carboxy-2-methyl-1,3-dioxane]-5-yloxycarbamoyl}-ethane
PDB Compounds: (D:) serum amyloid p-component

SCOPe Domain Sequences for d2a3wd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a3wd_ b.29.1.5 (D:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

SCOPe Domain Coordinates for d2a3wd_:

Click to download the PDB-style file with coordinates for d2a3wd_.
(The format of our PDB-style files is described here.)

Timeline for d2a3wd_: