Lineage for d2a3wd_ (2a3w D:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
    automatically mapped to Pfam PF00354
  6. Protein Serum amyloid P component (SAP) [49952] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [49953] (12 PDB entries)
  8. Domain d2a3wd_: 2a3w D: [126102]
    automated match to d1gyka_
    complexed with ca, cpj

Details for d2a3wd_

PDB Entry: 2a3w (more details), 2.2 Å

PDB Description: decameric structure of human serum amyloid p-component bound to bis-1, 2-{[(z)-2-carboxy-2-methyl-1,3-dioxane]-5-yloxycarbamoyl}-ethane
PDB Compounds: (D:) serum amyloid p-component

SCOPe Domain Sequences for d2a3wd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a3wd_ b.29.1.5 (D:) Serum amyloid P component (SAP) {Human (Homo sapiens) [TaxId: 9606]}
htdlsgkvfvfpresvtdhvnlitplekplqnftlcfraysdlsrayslfsyntqgrdne
llvykervgeyslyigrhkvtskviekfpapvhicvswesssgiaefwingtplvkkglr
qgyfveaqpkivlgqeqdsyggkfdrsqsfvgeigdlymwdsvlppenilsayqgtplpa
nildwqalnyeirgyviikplvwv

SCOPe Domain Coordinates for d2a3wd_ are not available.

Timeline for d2a3wd_:

Domains from other chains:
(mouse over for more information)
d2a3wa_, d2a3wb_, d2a3wc_, d2a3we_, d2a3wf_, d2a3wg_, d2a3wh_, d2a3wi_, d2a3wj_, d2a3wk_, d2a3wl_, d2a3wm_, d2a3wn_, d2a3wo_, d2a3wp_, d2a3wq_, d2a3wr_, d2a3ws_, d2a3wt_