SCOP 1.73: Domain d2a2ra2: 2a2r A:1-77

Lineage for d2a2ra2 (2a2r A:1-77)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Class pi GST [81358] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52864] (39 PDB entries)

8. Domain d2a2ra2: 2a2r A:1-77 [126059]
   Other proteins in same PDB: d2a2ra1, d2a2rb1
   automatically matched to d1gssa2
   complexed with ca, co3, gsn, mes

Details for d2a2ra2

PDB Entry: 2a2r, 1.4 Å

PDB Description: Crystal Structure of Glutathione Transferase Pi in complex with S-nitrosoglutathione

PDB Compounds: (A:) Glutathione S-transferase P

SCOP Domain Sequences for d2a2ra2:

Sequence; same for both SEQRES and ATOM records:

>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}
ppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpkfqdgdl
tlyqsntilrhlgrtlg

Timeline for d2a2ra2:

• d2a2ra2 is new in SCOP 1.73
  
• d2a2ra2 appears in SCOP 1.75
  
• d2a2ra2 appears in the current release, SCOPe 2.08