Class a: All alpha proteins [46456] (258 folds) |
Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins) |
Protein Class pi GST [81347] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [47619] (39 PDB entries) |
Domain d2a2rb1: 2a2r B:78-209 [126060] Other proteins in same PDB: d2a2ra2, d2a2rb2 automatically matched to d10gsa1 complexed with ca, co3, gsn, mes |
PDB Entry: 2a2r (more details), 1.4 Å
SCOP Domain Sequences for d2a2rb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a2rb1 a.45.1.1 (B:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} lygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvkalpgqlkpfetllsqnq ggktfivgdqisfadynlldlllihevlapgcldafpllsayvgrlsarpklkaflaspe yvnlpingngkq
Timeline for d2a2rb1: