![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
![]() | Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
![]() | Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
![]() | Protein Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain [141515] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141516] (1 PDB entry) Uniprot Q96BP3 483-646 |
![]() | Domain d2a2nc_: 2a2n C: [126043] automated match to d2a2na1 complexed with gol |
PDB Entry: 2a2n (more details), 1.65 Å
SCOPe Domain Sequences for d2a2nc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a2nc_ b.62.1.1 (C:) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} tqaegpkrvsdsaiihtsmgdihtklfpvecpktvenfcvhsrngyynghtfhriikgfm iqtgdptgtgmggesiwggefedefhstlrhdrpytlsmanagsntngsqffitvvptpw ldnkhtvfgrvtkgmevvqrisnvkvnpktdkpyedvsiinitvk
Timeline for d2a2nc_: