Lineage for d2a2na1 (2a2n A:483-646)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2806645Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2806646Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2806647Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2806989Protein Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain [141515] (1 species)
  7. 2806990Species Human (Homo sapiens) [TaxId:9606] [141516] (1 PDB entry)
    Uniprot Q96BP3 483-646
  8. 2806991Domain d2a2na1: 2a2n A:483-646 [126041]
    complexed with gol

Details for d2a2na1

PDB Entry: 2a2n (more details), 1.65 Å

PDB Description: Crystal Structure of the peptidylprolyl isomerase domain of Human PPWD1
PDB Compounds: (A:) peptidylprolyl isomerase domain and WD repeat containing 1

SCOPe Domain Sequences for d2a2na1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
qaegpkrvsdsaiihtsmgdihtklfpvecpktvenfcvhsrngyynghtfhriikgfmi
qtgdptgtgmggesiwggefedefhstlrhdrpytlsmanagsntngsqffitvvptpwl
dnkhtvfgrvtkgmevvqrisnvkvnpktdkpyedvsiinitvk

SCOPe Domain Coordinates for d2a2na1:

Click to download the PDB-style file with coordinates for d2a2na1.
(The format of our PDB-style files is described here.)

Timeline for d2a2na1: