Lineage for d2a1mb_ (2a1m B:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1094812Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 1094813Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 1094814Family a.104.1.1: Cytochrome P450 [48265] (23 proteins)
  6. 1094979Protein Cytochrome P450-CAM [48266] (1 species)
  7. 1094980Species Pseudomonas putida [TaxId:303] [48267] (94 PDB entries)
    Uniprot P00183
  8. 1095069Domain d2a1mb_: 2a1m B: [126004]
    automated match to d1t87a_
    complexed with cam, hem, k, oxy, trs

Details for d2a1mb_

PDB Entry: 2a1m (more details), 2.1 Å

PDB Description: crystal structure of ferrous dioxygen complex of wild-type cytochrome p450cam
PDB Compounds: (B:) Cytochrome P450-cam

SCOPe Domain Sequences for d2a1mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a1mb_ a.104.1.1 (B:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOPe Domain Coordinates for d2a1mb_:

Click to download the PDB-style file with coordinates for d2a1mb_.
(The format of our PDB-style files is described here.)

Timeline for d2a1mb_: