Lineage for d2a1mb1 (2a1m B:10-414)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646332Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 646333Superfamily a.104.1: Cytochrome P450 [48264] (1 family) (S)
  5. 646334Family a.104.1.1: Cytochrome P450 [48265] (21 proteins)
  6. 646437Protein Cytochrome P450-CAM [48266] (1 species)
  7. 646438Species Pseudomonas putida [TaxId:303] [48267] (57 PDB entries)
  8. 646491Domain d2a1mb1: 2a1m B:10-414 [126004]
    automatically matched to d1t87a_
    complexed with cam, hem, k, oxy, trs; mutant

Details for d2a1mb1

PDB Entry: 2a1m (more details), 2.1 Å

PDB Description: crystal structure of ferrous dioxygen complex of wild-type cytochrome p450cam
PDB Compounds: (B:) Cytochrome P450-cam

SCOP Domain Sequences for d2a1mb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a1mb1 a.104.1.1 (B:10-414) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]}
nlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrgq
lireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdklen
riqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpdg
smtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvgg
ldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefhg
vqlkkgdqillpqmlsglderenaapmhvdfsrqkvshttfghgshlclgqhlarreiiv
tlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav

SCOP Domain Coordinates for d2a1mb1:

Click to download the PDB-style file with coordinates for d2a1mb1.
(The format of our PDB-style files is described here.)

Timeline for d2a1mb1:

Domains from other chains:
(mouse over for more information)
d2a1ma1