SCOPe 2.02: Domain d2a1jb1: 2a1j B:219-296

Lineage for d2a1jb1 (2a1j B:219-296)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.2: RuvA domain 2-like [47781] (7 families)
   duplication: contains two helix-hairpin-helix (HhH) motifs

5. Family a.60.2.5: Hef domain-like [140629] (3 proteins)
   helicase/nuclease domain; forms homo and heterodimers; probably includes the Excinuclease UvrC C-terminal domain ((81795), that contains a single NMR structure of a monomeric truncated domain, 1kft)

6. Protein DNA excision repair protein ERCC-1 [140630] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [140631] (2 PDB entries)
   Uniprot P07992 219-296! Uniprot P07992 220-297

8. Domain d2a1jb1: 2a1j B:219-296 [126001]
   Other proteins in same PDB: d2a1ja1
   protein/DNA complex; complexed with hg

Details for d2a1jb1

PDB Entry: 2a1j, 2.7 Å

PDB Description: Crystal Structure of the Complex between the C-Terminal Domains of Human XPF and ERCC1

PDB Compounds: (B:) DNA excision repair protein ERCC-1

SCOPe Domain Sequences for d2a1jb1:

Sequence; same for both SEQRES and ATOM records:

>d2a1jb1 a.60.2.5 (B:219-296) DNA excision repair protein ERCC-1 {Human (Homo sapiens) [TaxId: 9606]}
padllmekleqdfvsrvteclttvksvnktdsqtllttfgsleqliaasredlalcpglg
pqkarrlfdvlhepflkv

Timeline for d2a1jb1:

• d2a1jb1 first appeared in SCOP 1.73
  
• d2a1jb1 appears in SCOPe 2.01
  
• d2a1jb1 appears in SCOPe 2.03
  
• d2a1jb1 appears in the current release, SCOPe 2.08