Class a: All alpha proteins [46456] (284 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.2: RuvA domain 2-like [47781] (7 families) duplication: contains two helix-hairpin-helix (HhH) motifs |
Family a.60.2.5: Hef domain-like [140629] (3 proteins) helicase/nuclease domain; forms homo and heterodimers; probably includes the Excinuclease UvrC C-terminal domain ((81795), that contains a single NMR structure of a monomeric truncated domain, 1kft) |
Protein DNA repair endonuclease XPF [140634] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [140636] (3 PDB entries) Uniprot Q92889 823-905! Uniprot Q92889 837-898 |
Domain d2a1ja1: 2a1j A:837-898 [126000] Other proteins in same PDB: d2a1jb1 protein/DNA complex; complexed with hg |
PDB Entry: 2a1j (more details), 2.7 Å
SCOPe Domain Sequences for d2a1ja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a1ja1 a.60.2.5 (A:837-898) DNA repair endonuclease XPF {Human (Homo sapiens) [TaxId: 9606]} pqdfllkmpgvnakncrslmhhvkniaelaalsqdeltsilgnaanakqlydfihtsfae vv
Timeline for d2a1ja1: