SCOPe 2.01: Domain d1zzfa1: 1zzf A:2-80

Lineage for d1zzfa1 (1zzf A:2-80)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)

6. Protein Papillomavirus-1 E2 protein [54959] (5 species)
   forms dimers with subunit beta-sheets making (8,12) barrel

7. Species Human papillomavirus type 16 [TaxId:333760] [54962] (5 PDB entries)
   Uniprot P03120 286-365

8. Domain d1zzfa1: 1zzf A:2-80 [125902]
   automatically matched to d1by9__
   protein/DNA complex

Details for d1zzfa1

PDB Entry: 1zzf

PDB Description: the dna-bound solution structure of hpv-16 e2 dna-binding domain

PDB Compounds: (A:) Regulatory protein E2

SCOPe Domain Sequences for d1zzfa1:

Sequence; same for both SEQRES and ATOM records:

>d1zzfa1 d.58.8.1 (A:2-80) Papillomavirus-1 E2 protein {Human papillomavirus type 16 [TaxId: 333760]}
tpivhlkgdantlkclryrfkkhctlytavsstwhwtghnvkhksaivtltydsewqrdq
flsqvkipktitvstgfms

Timeline for d1zzfa1:

• d1zzfa1 first appeared in SCOP 1.73
  
• d1zzfa1 appears in SCOP 1.75
  
• d1zzfa1 appears in SCOPe 2.02
  
• d1zzfa1 appears in the current release, SCOPe 2.08, called d1zzfa_