SCOPe 2.08: Domain d1zzfa_: 1zzf A:

Lineage for d1zzfa_ (1zzf A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (3 proteins)

6. Protein Papillomavirus-1 E2 protein [54959] (5 species)
   forms dimers with subunit beta-sheets making (8,12) barrel

7. Species Human papillomavirus type 16 [TaxId:333760] [54962] (5 PDB entries)
   Uniprot P03120 286-365

8. Domain d1zzfa_: 1zzf A: [125902]
   automated match to d1r8pa_
   protein/DNA complex

Details for d1zzfa_

PDB Entry: 1zzf

PDB Description: the dna-bound solution structure of hpv-16 e2 dna-binding domain

PDB Compounds: (A:) Regulatory protein E2

SCOPe Domain Sequences for d1zzfa_:

Sequence; same for both SEQRES and ATOM records:

>d1zzfa_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Human papillomavirus type 16 [TaxId: 333760]}
mtpivhlkgdantlkclryrfkkhctlytavsstwhwtghnvkhksaivtltydsewqrd
qflsqvkipktitvstgfmsi

Timeline for d1zzfa_:

• d1zzfa_ first appeared in SCOP 1.73, called d1zzfa1
  
• d1zzfa_ appears in SCOPe 2.07