Lineage for d1zyrl2 (1zyr L:50-172)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2237535Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 2237536Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 2237537Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 2237538Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 2237553Species Thermus thermophilus [TaxId:274] [75595] (15 PDB entries)
    Uniprot Q9Z9H6; part of multichain biological unit
  8. 2237605Domain d1zyrl2: 1zyr L:50-172 [125862]
    Other proteins in same PDB: d1zyra1, d1zyrb1, d1zyrc_, d1zyrd_, d1zyre_, d1zyrf1, d1zyrf2, d1zyrf3, d1zyrk1, d1zyrl1, d1zyrm_, d1zyrn_, d1zyro_, d1zyrp1, d1zyrp2, d1zyrp3
    automatically matched to d1iw7a2
    protein/RNA complex; complexed with mg, std, zn

Details for d1zyrl2

PDB Entry: 1zyr (more details), 3 Å

PDB Description: Structure of Thermus thermophilus RNA polymerase holoenzyme in complex with the antibiotic streptolydigin
PDB Compounds: (L:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d1zyrl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zyrl2 d.181.1.1 (L:50-172) RNA polymerase alpha subunit {Thermus thermophilus [TaxId: 274]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrflnpslqtvtlllkaegpkev
kardflpvadveimnpdlhiatleeggrlnmevrvdrgvgyvpaekhgikdrinaipvda
vfs

SCOPe Domain Coordinates for d1zyrl2:

Click to download the PDB-style file with coordinates for d1zyrl2.
(The format of our PDB-style files is described here.)

Timeline for d1zyrl2: