Class a: All alpha proteins [46456] (289 folds) |
Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily) multihelical; consists of a conserved 4-helical core and a variable insert subdomain |
Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (2 families) |
Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (6 proteins) |
Protein automated matches [254474] (3 species) not a true protein |
Domain d1zyrf3: 1zyr F:74-257 [125858] Other proteins in same PDB: d1zyra1, d1zyra2, d1zyrb1, d1zyrb2, d1zyrc_, d1zyrd_, d1zyre_, d1zyrf1, d1zyrf2, d1zyrk1, d1zyrk2, d1zyrl1, d1zyrl2, d1zyrm_, d1zyrn_, d1zyro_, d1zyrp1, d1zyrp2 automated match to d1smyf3 protein/RNA complex; complexed with mg, std, zn |
PDB Entry: 1zyr (more details), 3 Å
SCOPe Domain Sequences for d1zyrf3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zyrf3 a.177.1.1 (F:74-257) automated matches {Thermus thermophilus [TaxId: 274]} kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad qart
Timeline for d1zyrf3: