Lineage for d1zyrf3 (1zyr F:74-257)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1285121Fold a.177: Sigma2 domain of RNA polymerase sigma factors [88945] (1 superfamily)
    multihelical; consists of a conserved 4-helical core and a variable insert subdomain
  4. 1285122Superfamily a.177.1: Sigma2 domain of RNA polymerase sigma factors [88946] (1 family) (S)
  5. 1285123Family a.177.1.1: Sigma2 domain of RNA polymerase sigma factors [88947] (5 proteins)
  6. 1285139Protein Sigma70 [88948] (2 species)
  7. 1285142Species Thermus thermophilus [TaxId:274] [88949] (10 PDB entries)
    Uniprot Q9WX78
  8. 1285159Domain d1zyrf3: 1zyr F:74-257 [125858]
    Other proteins in same PDB: d1zyra1, d1zyra2, d1zyrb1, d1zyrb2, d1zyrc1, d1zyrd1, d1zyre1, d1zyrf1, d1zyrf2, d1zyrk1, d1zyrk2, d1zyrl1, d1zyrl2, d1zyrm1, d1zyrn1, d1zyro1, d1zyrp1, d1zyrp2
    automatically matched to d1iw7f3
    protein/RNA complex; complexed with mg, std, zn

Details for d1zyrf3

PDB Entry: 1zyr (more details), 3 Å

PDB Description: Structure of Thermus thermophilus RNA polymerase holoenzyme in complex with the antibiotic streptolydigin
PDB Compounds: (F:) DNA-directed RNA polymerase sigma chain

SCOPe Domain Sequences for d1zyrf3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zyrf3 a.177.1.1 (F:74-257) Sigma70 {Thermus thermophilus [TaxId: 274]}
kistsdpvrqylheigqvplltleeevelarkveegmeaikklseitgldpdlirevvra
kilgsarvrhipglketldpktveeidqklkslpkehkrylhiaregeaarqhlieanlr
lvvsiakkytgrglsfldliqegnqgliravekfeykrrfkfstyatwwirqainraiad
qart

SCOPe Domain Coordinates for d1zyrf3:

Click to download the PDB-style file with coordinates for d1zyrf3.
(The format of our PDB-style files is described here.)

Timeline for d1zyrf3: