Lineage for d1zyrp1 (1zyr P:258-318)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1260796Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) (S)
  5. 1260797Family a.4.13.1: Sigma3 domain [88660] (3 proteins)
  6. 1260809Protein Sigma70 [88661] (1 species)
  7. 1260810Species Thermus thermophilus [TaxId:274] [88662] (10 PDB entries)
    Uniprot Q9WX78
  8. 1260828Domain d1zyrp1: 1zyr P:258-318 [125866]
    Other proteins in same PDB: d1zyra1, d1zyra2, d1zyrb1, d1zyrb2, d1zyrc1, d1zyrd1, d1zyre1, d1zyrf2, d1zyrf3, d1zyrk1, d1zyrk2, d1zyrl1, d1zyrl2, d1zyrm1, d1zyrn1, d1zyro1, d1zyrp2, d1zyrp3
    automatically matched to d1iw7f1
    protein/RNA complex; complexed with mg, std, zn

Details for d1zyrp1

PDB Entry: 1zyr (more details), 3 Å

PDB Description: Structure of Thermus thermophilus RNA polymerase holoenzyme in complex with the antibiotic streptolydigin
PDB Compounds: (P:) DNA-directed RNA polymerase sigma chain

SCOPe Domain Sequences for d1zyrp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zyrp1 a.4.13.1 (P:258-318) Sigma70 {Thermus thermophilus [TaxId: 274]}
iripvhmvetinklsrtarqlqqelgreptyeeiaeamgpgwdakrveetlkiaqepvsl
e

SCOPe Domain Coordinates for d1zyrp1:

Click to download the PDB-style file with coordinates for d1zyrp1.
(The format of our PDB-style files is described here.)

Timeline for d1zyrp1: