Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (5 proteins) |
Protein Hypothetical protein BT3618 [142456] (1 species) |
Species Bacteroides thetaiotaomicron [TaxId:818] [142457] (1 PDB entry) Uniprot Q8A1P1 107-280! Uniprot Q8A1P1 3-106 |
Domain d1zxoe2: 1zxo E:107-280 [125793] automatically matched to 1ZXO A:107-280 |
PDB Entry: 1zxo (more details), 3.2 Å
SCOPe Domain Sequences for d1zxoe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zxoe2 c.55.1.5 (E:107-280) Hypothetical protein BT3618 {Bacteroides thetaiotaomicron [TaxId: 818]} kagiacilgtgsnscfyngkeivsnisplgfilgdegsgavlgkllvgdilknqlpatlk eeflkqfdltppeiidrvyrqpfpnrflaslspfiaqhleepairqlvmnsfiaffrrnv mqydykqypvhfigsiaycykeilqdaarqtgiqigkilqspmegliqyhsqls
Timeline for d1zxoe2: