![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (9 proteins) |
![]() | Domain d1zxoe2: 1zxo E:107-280 [125793] Other proteins in same PDB: d1zxoa1, d1zxob1, d1zxoc1, d1zxod1, d1zxoe1, d1zxof1 automatically matched to 1ZXO A:107-280 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1zxo (more details), 3.2 Å
SCOPe Domain Sequences for d1zxoe2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zxoe2 c.55.1.5 (E:107-280) Hypothetical protein BT3618, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} kagiacilgtgsnscfyngkeivsnisplgfilgdegsgavlgkllvgdilknqlpatlk eeflkqfdltppeiidrvyrqpfpnrflaslspfiaqhleepairqlvmnsfiaffrrnv mqydykqypvhfigsiaycykeilqdaarqtgiqigkilqspmegliqyhsqls
Timeline for d1zxoe2: