SCOPe 2.08: Domain d1zxoe2: 1zxo E:107-280

Lineage for d1zxoe2 (1zxo E:107-280)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (9 proteins)

6. Protein Hypothetical protein BT3618, C-terminal domain [418989] (1 species)
7. Species Bacteroides thetaiotaomicron [TaxId:818] [419461] (1 PDB entry)
   Uniprot Q8A1P1

8. Domain d1zxoe2: 1zxo E:107-280 [125793]
   Other proteins in same PDB: d1zxoa1, d1zxob1, d1zxoc1, d1zxod1, d1zxoe1, d1zxof1
   automatically matched to 1ZXO A:107-280
   has additional insertions and/or extensions that are not grouped together

Details for d1zxoe2

PDB Entry: 1zxo, 3.2 Å

PDB Description: X-ray Crystal Structure of Protein Q8A1P1 from Bacteroides thetaiotaomicron. Northeast Structural Genomics Consortium Target BtR25.

PDB Compounds: (E:) conserved hypothetical protein Q8A1P1

SCOPe Domain Sequences for d1zxoe2:

Sequence; same for both SEQRES and ATOM records:

>d1zxoe2 c.55.1.5 (E:107-280) Hypothetical protein BT3618, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
kagiacilgtgsnscfyngkeivsnisplgfilgdegsgavlgkllvgdilknqlpatlk
eeflkqfdltppeiidrvyrqpfpnrflaslspfiaqhleepairqlvmnsfiaffrrnv
mqydykqypvhfigsiaycykeilqdaarqtgiqigkilqspmegliqyhsqls

Timeline for d1zxoe2:

• d1zxoe2 first appeared in SCOP 1.73
  
• d1zxoe2 appears in SCOPe 2.07