| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (9 proteins) |
| Domain d1zxob2: 1zxo B:107-280 [125787] Other proteins in same PDB: d1zxoa1, d1zxob1, d1zxoc1, d1zxod1, d1zxoe1, d1zxof1 automatically matched to 1ZXO A:107-280 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1zxo (more details), 3.2 Å
SCOPe Domain Sequences for d1zxob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zxob2 c.55.1.5 (B:107-280) Hypothetical protein BT3618, C-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
kagiacilgtgsnscfyngkeivsnisplgfilgdegsgavlgkllvgdilknqlpatlk
eeflkqfdltppeiidrvyrqpfpnrflaslspfiaqhleepairqlvmnsfiaffrrnv
mqydykqypvhfigsiaycykeilqdaarqtgiqigkilqspmegliqyhsqls
Timeline for d1zxob2: