| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.5: BadF/BadG/BcrA/BcrD-like [64089] (9 proteins) |
| Protein Hypothetical protein BT3618, N-terminal domain [418988] (1 species) |
| Species Bacteroides thetaiotaomicron [TaxId:818] [419460] (1 PDB entry) Uniprot Q8A1P1 |
| Domain d1zxof1: 1zxo F:3-106 [125794] Other proteins in same PDB: d1zxoa2, d1zxob2, d1zxoc2, d1zxod2, d1zxoe2, d1zxof2 automatically matched to 1ZXO A:3-106 |
PDB Entry: 1zxo (more details), 3.2 Å
SCOPe Domain Sequences for d1zxof1:
Sequence, based on SEQRES records: (download)
>d1zxof1 c.55.1.5 (F:3-106) Hypothetical protein BT3618, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
liadsgstktdwcvvlngavikrlgtkginpffqseeeiqqkltasllpqlpegkfnavy
fygagctpekapvlrraiadslpvignikansdmlaaahglcgq
>d1zxof1 c.55.1.5 (F:3-106) Hypothetical protein BT3618, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]}
liadsgstktdwcvlngikrlgtkginpffqseeeiqqkltasllpqlpegkfnavyfyg
agctpekapvlrraiadslpvignikansdmlaaahglcgq
Timeline for d1zxof1: